PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g02650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 199aa    MW: 21739.6 Da    PI: 5.2176
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g02650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601352.9e-42331321100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe +r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+l
  Vradi04g02650.1  33 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPEGQRADAVASMVYEAGARIRDPVYGCAGAICQLQKQVNELQAQL 126
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Vradi04g02650.1 127 AKAQAE 132
                      **9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.75632133IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4233130IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MESDANTLTS SPTFSHSSNT LSSSSPPQVV MTPCAACKIL RRRCAEKCVL APYFPPTEPA  60
KFTIAHRVFG ASNIIKFLQE LPEGQRADAV ASMVYEAGAR IRDPVYGCAG AICQLQKQVN  120
ELQAQLAKAQ AEVVNMQFQQ ANLVALICME MSQTPQESPQ QSVDNFIASP SRSSGYQNNL  180
SFFEDNTNLN SLWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-156AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497455.11e-146PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-81LBD1_ARATH; LOB domain-containing protein 1
TrEMBLV7C0151e-127V7C015_PHAVU; Uncharacterized protein
STRINGGLYMA13G40370.21e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-73LOB domain-containing protein 1